PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_020005-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family SRS
Protein Properties Length: 465aa    MW: 47956.1 Da    PI: 7.7552
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_020005-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702219.29.1e-682554143153
         DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskk 98 
                    s++++CqdCGnqakkdC+h+RCRtCCksrgfdC+thvkstWvpaa+rrerq  ++aa++ a +s +++a k++r   s++++++s+t++s++++++
  NNU_020005-RA 255 STATTCQDCGNQAKKDCSHRRCRTCCKSRGFDCSTHVKSTWVPAARRRERQLSATAAAAAAGSSVSTSAVKKPRLI-SSQTTTASHTSTSNTTPPR 349
                    56789**********************************************99999999999999*********86.7888999999********* PP

         DUF702  99 eletss..........lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                    +++tss          lP +++++avf+cvrv++v+dge+e+aYq+ v+igGhvfkG+LydqG++
  NNU_020005-RA 350 SFDTSSshqdasfretLPGQIRAPAVFKCVRVTAVEDGEDEYAYQAIVKIGGHVFKGFLYDQGVD 414
                    ****999********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.0E-61258414IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016236.8E-27259301IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.0E-29366413IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0048364Biological Processroot development
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MKMLVTAIIP FDVEKSFSVS MKNAGFEVGT PWSKGTLDLL AEAAVVATTR RLPSDSGAFA  60
DWVASSSTTG RADDLSLGFN AGAAGGGHGS ATATGGGGGG PGAGWSSSTR QISYGLPPEM  120
GMVGLRDVLV VAPASSFHHN QQHEPILSDH HHQINNSNAA TALGVGVGVG VIPLLTAAPC  180
LAPANVGIDD GDNMNNRNRG CGINLWQNQQ PHHGNYLKKP MLIDHNNSEN LLNSSNSGGC  240
GAAGSGGLGG TTTTSTATTC QDCGNQAKKD CSHRRCRTCC KSRGFDCSTH VKSTWVPAAR  300
RRERQLSATA AAAAAGSSVS TSAVKKPRLI SSQTTTASHT STSNTTPPRS FDTSSSHQDA  360
SFRETLPGQI RAPAVFKCVR VTAVEDGEDE YAYQAIVKIG GHVFKGFLYD QGVDGRDGFP  420
NISELHLGGG RNGNSSSPNM LDPSDVYAAS GGGLLGGTAY GNPIN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010276642.10.0PREDICTED: protein LATERAL ROOT PRIMORDIUM 1-like
SwissprotQ94CK93e-90LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLA5BRG11e-162A5BRG1_VITVI; Putative uncharacterized protein (Fragment)
STRINGVIT_06s0009g03450.t011e-152(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.21e-67Lateral root primordium (LRP) protein-related